Lineage for d3ov6a2 (3ov6 A:8-184)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2163004Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2163005Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2163984Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2163985Protein automated matches [226842] (4 species)
    not a true protein
  7. 2163998Species Human (Homo sapiens) [TaxId:9606] [226044] (64 PDB entries)
  8. 2164043Domain d3ov6a2: 3ov6 A:8-184 [248353]
    Other proteins in same PDB: d3ov6a1, d3ov6a3, d3ov6a4, d3ov6a5
    automated match to d1onqa2
    complexed with d12, mk0, nag

Details for d3ov6a2

PDB Entry: 3ov6 (more details), 2.5 Å

PDB Description: cd1c in complex with mpm (mannosyl-beta1-phosphomycoketide)
PDB Compounds: (A:) Beta-2-microglobulin, T-cell surface glycoprotein CD1c, T-cell surface glycoprotein CD1b

SCOPe Domain Sequences for d3ov6a2:

Sequence, based on SEQRES records: (download)

>d3ov6a2 d.19.1.0 (A:8-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle
llfrfylfgltreiqdhasqdyskypfevqvkagcelhsggspegffqvafngldllsfq
qttwvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

Sequence, based on observed residues (ATOM records): (download)

>d3ov6a2 d.19.1.0 (A:8-184) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsfhviqifsfvnqswargqgsgwldelqthgwdsesgtiiflhqwskgqfsneelsdle
llfrfylfgltreiqdhasskypfevqvkagcelhsggspegffqvafngldllsfqqtt
wvpspgcgslaqsvchllnhqyegvtetvynlirstcprfllglldagkmyvhr

SCOPe Domain Coordinates for d3ov6a2:

Click to download the PDB-style file with coordinates for d3ov6a2.
(The format of our PDB-style files is described here.)

Timeline for d3ov6a2: