Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (11 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (157 PDB entries) |
Domain d3oeub_: 3oeu B: [233083] Other proteins in same PDB: d3oeu1_, d3oeu2_, d3oeua_, d3oeuc_, d3oeue_, d3oeuf_, d3oeug_, d3oeuh_, d3oeui_, d3oeuj_, d3oeuk_, d3oeul_, d3oeum_, d3oeun_, d3oeuo_, d3oeuq_, d3oeus_, d3oeut_, d3oeuu_, d3oeuv_, d3oeuw_, d3oeux_, d3oeuy_, d3oeuz_ automated match to d1rypc_ complexed with mes, mg, oeu |
PDB Entry: 3oeu (more details), 2.6 Å
SCOPe Domain Sequences for d3oeub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oeub_ d.153.1.4 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdtsteklykln dkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqgytqhgglrp fgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdykddmkvddai elalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvktgit
Timeline for d3oeub_:
View in 3D Domains from other chains: (mouse over for more information) d3oeu1_, d3oeu2_, d3oeua_, d3oeuc_, d3oeud_, d3oeue_, d3oeuf_, d3oeug_, d3oeuh_, d3oeui_, d3oeuj_, d3oeuk_, d3oeul_, d3oeum_, d3oeun_, d3oeuo_, d3oeup_, d3oeuq_, d3oeur_, d3oeus_, d3oeut_, d3oeuu_, d3oeuv_, d3oeuw_, d3oeux_, d3oeuy_, d3oeuz_ |