Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
Protein automated matches [191209] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189839] (36 PDB entries) |
Domain d3o5qa_: 3o5q A: [214195] automated match to d4drja_ complexed with dms; mutant |
PDB Entry: 3o5q (more details), 0.96 Å
SCOPe Domain Sequences for d3o5qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3o5qa_ d.26.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} gapatvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshd rnepfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffei elldfkge
Timeline for d3o5qa_: