Lineage for d3nava_ (3nav A:)
- Root: SCOPe 2.05
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
the first seven superfamilies have similar phosphate-binding sites
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) 
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins) Protein automated matches [190053] (8 species)
not a true protein
Species Vibrio cholerae [TaxId:243277] [189383] (1 PDB entry) 
Domain d3nava_: 3nav A: [182120]
automated match to d1bksa_
complexed with edo
Details for d3nava_
PDB Entry: 3nav (more details), 2.1 Å
PDB Description: Crystal structure of an alpha subunit of tryptophan synthase from Vibrio cholerae O1 biovar El Tor str. N16961
PDB Compounds: (A:) tryptophan synthase alpha chainSCOPe Domain Sequences for d3nava_:
Sequence, based on SEQRES records: (download)
>d3nava_ c.1.2.4 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
amnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdpla
dgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqrcq
kagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyllsr
agvtgaetkanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsavvk
iiethldnpakqltelanftqamkkatki
Sequence, based on observed residues (ATOM records): (download)
>d3nava_ c.1.2.4 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
amnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdpla
dgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqrcq
kagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyllsr
aanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsavvkiiethldn
pakqltelanftqamkkatki
SCOPe Domain Coordinates for d3nava_:
Click to download the PDB-style file with coordinates for d3nava_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3nava_:
- d3nava_ first appeared in SCOPe 2.01
- d3nava_ appears in SCOPe 2.04
- d3nava_ is called d3nava1 in SCOPe 2.06
- d3nava_ appears in the current release, SCOPe 2.08, called d3nava1
View in 3D
