Lineage for d3nava_ (3nav A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 968086Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 968402Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 968791Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 968899Protein automated matches [190053] (7 species)
    not a true protein
  7. 968929Species Vibrio cholerae [TaxId:243277] [189383] (1 PDB entry)
  8. 968930Domain d3nava_: 3nav A: [182120]
    automated match to d1bksa_
    complexed with edo

Details for d3nava_

PDB Entry: 3nav (more details), 2.1 Å

PDB Description: Crystal structure of an alpha subunit of tryptophan synthase from Vibrio cholerae O1 biovar El Tor str. N16961
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d3nava_:

Sequence, based on SEQRES records: (download)

>d3nava_ c.1.2.4 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
amnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdpla
dgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqrcq
kagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyllsr
agvtgaetkanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsavvk
iiethldnpakqltelanftqamkkatki

Sequence, based on observed residues (ATOM records): (download)

>d3nava_ c.1.2.4 (A:) automated matches {Vibrio cholerae [TaxId: 243277]}
amnryqalfqrlsaaqqgafvpfvtigdpnpeqslaimqtlidagadalelgmpfsdpla
dgptiqganlralaakttpdicfeliaqirarnpetpigllmyanlvyargiddfyqrcq
kagvdsvliadvptnesqpfvaaaekfgiqpifiapptasdetlravaqlgkgytyllsr
aanmpvhallerlqqfdappallgfgisepaqvkqaieagaagaisgsavvkiiethldn
pakqltelanftqamkkatki

SCOPe Domain Coordinates for d3nava_:

Click to download the PDB-style file with coordinates for d3nava_.
(The format of our PDB-style files is described here.)

Timeline for d3nava_: