Lineage for d3mxjb_ (3mxj B:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the restSuperfamily c.55.3: Ribonuclease H-like [53098] (18 families) 
consists of one domain of this fold
Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
contains Pfam PF00929
Protein Three prime repair exonuclease 1, TREX1 [159631] (1 species) Species Mouse (Mus musculus) [TaxId:10090] [159632] (7 PDB entries)
Uniprot Q91XB0 5-234! Uniprot Q91XB0 9-234
Domain d3mxjb_: 3mxj B: [181680]
automated match to d2ioca1
Details for d3mxjb_
PDB Entry: 3mxj (more details), 1.95 Å
PDB Description: Crystal Structure of the mTREX1 Apoprotein
PDB Compounds: (B:) Three prime repair exonuclease 1SCOPe Domain Sequences for d3mxjb_:
Sequence, based on SEQRES records: (download)
>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
qtlphghmqtlifldleatglpssrpevtelcllavhrralentsisqghpppvprpprv
vdklslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclva
hngdrydfpllqtelarlstpspldgtfcvdsiaalkaleqasspsgngsrksyslgsiy
trlywqaptdshtaegdvltllsicqwkpqallqwvdeharpfstvkpmyg
Sequence, based on observed residues (ATOM records): (download)
>d3mxjb_ c.55.3.5 (B:) Three prime repair exonuclease 1, TREX1 {Mouse (Mus musculus) [TaxId: 10090]}
qtlphghmqtlifldleatglpssrpevtelcllavhrralentsghpppvprpprvvdk
lslciapgkacspgaseitglskaelevqgrqrfddnlaillraflqrqpqpcclvahng
drydfpllqtelarlstpspldgtfcvdsiaalkaleqaksyslgsiytrlywqaptdsh
taegdvltllsicqwkpqallqwvdeharpfstvkpmyg
SCOPe Domain Coordinates for d3mxjb_:
Click to download the PDB-style file with coordinates for d3mxjb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3mxjb_:
- d3mxjb_ first appeared in SCOPe 2.01
- d3mxjb_ appears in SCOPe 2.07
View in 3D
