Lineage for d3mpsa2 (3mps A:135-171)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3036286Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 3036508Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 3036792Family g.41.5.0: automated matches [232942] (1 protein)
    not a true family
  6. 3036793Protein automated matches [232943] (4 species)
    not a true protein
  7. 3036818Species Pyrococcus furiosus [TaxId:2261] [232944] (4 PDB entries)
  8. 3036831Domain d3mpsa2: 3mps A:135-171 [232945]
    Other proteins in same PDB: d3mpsa1, d3mpsb1, d3mpsd1, d3mpsf1, d3mpsg1, d3mpsh1, d3mpsi1, d3mpsk1
    automated match to d1nnqa2
    complexed with fe, feo, peo

Details for d3mpsa2

PDB Entry: 3mps (more details), 2 Å

PDB Description: peroxide bound oxidized rubrerythrin from pyrococcus furiosus
PDB Compounds: (A:) rubrerythrin

SCOPe Domain Sequences for d3mpsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mpsa2 g.41.5.0 (A:135-171) automated matches {Pyrococcus furiosus [TaxId: 2261]}
eikkvyicpicgytavdeapeycpvcgapkekfvvfe

SCOPe Domain Coordinates for d3mpsa2:

Click to download the PDB-style file with coordinates for d3mpsa2.
(The format of our PDB-style files is described here.)

Timeline for d3mpsa2: