Lineage for d3mmcb1 (3mmc B:197-261)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555938Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2555939Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) (S)
  5. 2556102Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
    members of this "family" may be more closely related to other ferredoxins than to each other
  6. 2556176Protein DsrB insert domain [160277] (2 species)
  7. 2556177Species Archaeoglobus fulgidus [TaxId:2234] [160279] (9 PDB entries)
    Uniprot Q59110 197-261
  8. 2556180Domain d3mmcb1: 3mmc B:197-261 [181409]
    Other proteins in same PDB: d3mmca1, d3mmca2, d3mmca3, d3mmcb2, d3mmcb3, d3mmcd1, d3mmcd2, d3mmcd3, d3mmce2, d3mmce3
    complexed with gol, sf4, srm

Details for d3mmcb1

PDB Entry: 3mmc (more details), 2.04 Å

PDB Description: Structure of the dissimilatory sulfite reductase from Archaeoglobus fulgidus
PDB Compounds: (B:) sulfite reductase, dissimilatory-type subunit beta

SCOPe Domain Sequences for d3mmcb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mmcb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]}
rtppipndeairktceipstvaacptgalkpdmknktikvdvekcmycgncytmcpgmpl
fdpen

SCOPe Domain Coordinates for d3mmcb1:

Click to download the PDB-style file with coordinates for d3mmcb1.
(The format of our PDB-style files is described here.)

Timeline for d3mmcb1: