Lineage for d3mima_ (3mim A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1548217Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 1548218Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 1548219Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 1548235Protein Human immunodeficiency virus type 1 protease [50632] (8 species)
  7. Species Human immunodeficiency virus 1 [TaxId:11676] [224867] (42 PDB entries)
  8. 1548339Domain d3mima_: 3mim A: [191894]
    automated match to d2npha1

Details for d3mima_

PDB Entry: 3mim (more details), 1.76 Å

PDB Description: x-ray snapshot of hiv-1 protease in action: observation of tetrahedral intermediate and its sihb with catalytic aspartate
PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3mima_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mima_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigmtlnf

SCOPe Domain Coordinates for d3mima_:

Click to download the PDB-style file with coordinates for d3mima_.
(The format of our PDB-style files is described here.)

Timeline for d3mima_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3mimb_