PDB entry 3mim

View 3mim on RCSB PDB site
Description: X-ray Snapshot of HIV-1 Protease in Action: Observation of Tetrahedral Intermediate and Its SIHB with Catalytic Aspartate
Class: hydrolase
Keywords: HIV-1 protease, Short ionic hydrogen bond, tethered dimer, tetrahedral intermediate, Reverse Transcriptase-RNAseH oligopeptide substrate, Reaction Mechanism, HYDROLASE
Deposited on 2010-04-11, released 2011-04-13
Made obsolete by 5yrs on 2018-03-07

The last revision prior to the SCOPe 2.04 freeze date was dated 2011-04-13, with a file datestamp of 2011-04-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.223
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11706]
    Gene: gag-pol, HIV-1 PR B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered mutation (94)
    Domains in SCOPe 2.04: d3mima_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11706]
    Gene: gag-pol, HIV-1 PR B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (0-98)
      • engineered mutation (94)
      • expression tag (99-102)
    Domains in SCOPe 2.04: d3mimb_
  • Chain 'X':
    Compound: peptide ET(PHD)YVD
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3MIM (0-5)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3mimA (A:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigmtlnf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3mimB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnfggssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3mimB (B:)
    pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
    qilieicghkaigtvlvgptpvniigrnlltqigatlnfggss
    

  • Chain 'X':
    No sequence available.