Lineage for d3lhra_ (3lhr A:)
- Root: SCOPe 2.04
Class a: All alpha proteins [46456] (285 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-downSuperfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) 
Family a.28.3.0: automated matches [191629] (1 protein)
not a true familyProtein automated matches [191156] (6 species)
not a true proteinSpecies Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries) 
Domain d3lhra_: 3lhr A: [180288]
automated match to d1y7qa1
complexed with cl, emc, mg, peg
Details for d3lhra_
PDB Entry: 3lhr (more details), 1.9 Å
PDB Description: crystal structure of the scan domain from human znf24
PDB Compounds: (A:) Zinc finger protein 24SCOPe Domain Sequences for d3lhra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lhra_ a.28.3.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gspdpeifrqrfrqfgyqdspgpreavsqlrelcrlwlrpethtkeqilelvvleqfvai
lpkelqtwvrdhhpengeeavtvledleseld
SCOPe Domain Coordinates for d3lhra_:
Click to download the PDB-style file with coordinates for d3lhra_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lhra_:
- d3lhra_ first appeared in SCOPe 2.01
- d3lhra_ appears in SCOPe 2.03
- d3lhra_ appears in SCOPe 2.05
- d3lhra_ appears in the current release, SCOPe 2.08, called d3lhra1
View in 3D
