SCOPe 2.08: Domain d3lhra1: 3lhr A:3-92

Lineage for d3lhra1 (3lhr A:3-92)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189328] (2 PDB entries)

8. Domain d3lhra1: 3lhr A:3-92 [180288]
   Other proteins in same PDB: d3lhra2, d3lhrb2
   automated match to d1y7qa1
   complexed with cl, emc, mg, peg

Details for d3lhra1

PDB Entry: 3lhr, 1.9 Å

PDB Description: crystal structure of the scan domain from human znf24

PDB Compounds: (A:) Zinc finger protein 24

SCOPe Domain Sequences for d3lhra1:

Sequence; same for both SEQRES and ATOM records:

>d3lhra1 a.28.3.0 (A:3-92) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pdpeifrqrfrqfgyqdspgpreavsqlrelcrlwlrpethtkeqilelvvleqfvailp
kelqtwvrdhhpengeeavtvledleseld

Timeline for d3lhra1:

• d3lhra1 first appeared in SCOPe 2.01, called d3lhra_
  
• d3lhra1 appears in SCOPe 2.07