Lineage for d3lasa_ (3las A:)
- Root: SCOPe 2.03
Class c: Alpha and beta proteins (a/b) [51349] (147 folds) 
Fold c.53: Resolvase-like [53040] (2 superfamilies)
Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the restSuperfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) 
Family c.53.2.0: automated matches [191506] (1 protein)
not a true familyProtein automated matches [190830] (3 species)
not a true proteinSpecies Streptococcus mutans [TaxId:1309] [189597] (1 PDB entry) 
Domain d3lasa_: 3las A: [180143]
automated match to d1g5ca_
complexed with gai, gol, mg, zn
Details for d3lasa_
PDB Entry: 3las (more details), 1.4 Å
PDB Description: Crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution
PDB Compounds: (A:) Putative carbonic anhydraseSCOPe Domain Sequences for d3lasa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3lasa_ c.53.2.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
mvmsyfdnfikanqayvdlhgtahlplkpktrvaivtcmdsrlhvapalglalgdahilr
naggrvtddvirslviseqqlgtseivvlhhtdcgaqtftnaefteqlkrdlavdagdqd
flpftdieesvrediallknsplipediiisgaiydvdtgrvrevn
SCOPe Domain Coordinates for d3lasa_:
Click to download the PDB-style file with coordinates for d3lasa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3lasa_:
- d3lasa_ first appeared in SCOPe 2.01
- d3lasa_ appears in SCOPe 2.02
- d3lasa_ appears in SCOPe 2.04
- d3lasa_ appears in the current release, SCOPe 2.08
View in 3D
