PDB entry 3las

View 3las on RCSB PDB site
Description: Crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution
Class: Lyase
Keywords: carbonic anhydrase, Zinc binding, streptococcus mutans, Lyase
Deposited on 2010-01-07, released 2011-01-12
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-01-12, with a file datestamp of 2011-01-07.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.156
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative carbonic anhydrase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: SMU_328
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lasa_
  • Chain 'B':
    Compound: Putative carbonic anhydrase
    Species: Streptococcus mutans [TaxId:1309]
    Gene: SMU_328
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3lasb_
  • Heterogens: ZN, MG, GOL, GAI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lasA (A:)
mvmsyfdnfikanqayvdlhgtahlplkpktrvaivtcmdsrlhvapalglalgdahilr
naggrvtddvirslviseqqlgtseivvlhhtdcgaqtftnaefteqlkrdlavdagdqd
flpftdieesvrediallknsplipediiisgaiydvdtgrvrevn

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3lasB (B:)
mvmsyfdnfikanqayvdlhgtahlplkpktrvaivtcmdsrlhvapalglalgdahilr
naggrvtddvirslviseqqlgtseivvlhhtdcgaqtftnaefteqlkrdlavdagdqd
flpftdieesvrediallknsplipediiisgaiydvdtgrvrevn