Lineage for d3lasa_ (3las A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883013Fold c.53: Resolvase-like [53040] (2 superfamilies)
    Core: 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 21345; strand 5 is antiparallel to the rest
  4. 2883078Superfamily c.53.2: beta-carbonic anhydrase, cab [53056] (2 families) (S)
  5. 2883196Family c.53.2.0: automated matches [191506] (1 protein)
    not a true family
  6. 2883197Protein automated matches [190830] (15 species)
    not a true protein
  7. 2883294Species Streptococcus mutans [TaxId:1309] [189597] (1 PDB entry)
  8. 2883295Domain d3lasa_: 3las A: [180143]
    automated match to d1g5ca_
    complexed with gai, gol, mg, zn

Details for d3lasa_

PDB Entry: 3las (more details), 1.4 Å

PDB Description: Crystal structure of carbonic anhydrase from streptococcus mutans to 1.4 angstrom resolution
PDB Compounds: (A:) Putative carbonic anhydrase

SCOPe Domain Sequences for d3lasa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3lasa_ c.53.2.0 (A:) automated matches {Streptococcus mutans [TaxId: 1309]}
mvmsyfdnfikanqayvdlhgtahlplkpktrvaivtcmdsrlhvapalglalgdahilr
naggrvtddvirslviseqqlgtseivvlhhtdcgaqtftnaefteqlkrdlavdagdqd
flpftdieesvrediallknsplipediiisgaiydvdtgrvrevn

SCOPe Domain Coordinates for d3lasa_:

Click to download the PDB-style file with coordinates for d3lasa_.
(The format of our PDB-style files is described here.)

Timeline for d3lasa_: