Lineage for d3kmda_ (3kmd A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377884Protein automated matches [190198] (2 species)
    not a true protein
  7. 2377885Species Human (Homo sapiens) [TaxId:9606] [186941] (51 PDB entries)
  8. 2377982Domain d3kmda_: 3kmd A: [179438]
    automated match to d1gzha_
    protein/DNA complex; complexed with zn

Details for d3kmda_

PDB Entry: 3kmd (more details), 2.15 Å

PDB Description: crystal structure of the p53 core domain bound to a full consensus site as a self-assembled tetramer
PDB Compounds: (A:) Cellular tumor antigen p53

SCOPe Domain Sequences for d3kmda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kmda_ b.2.5.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
plsssvpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstp
ppgtrvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrnt
frhsvvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfe
vrvcacpgrdrrteeenlrk

SCOPe Domain Coordinates for d3kmda_:

Click to download the PDB-style file with coordinates for d3kmda_.
(The format of our PDB-style files is described here.)

Timeline for d3kmda_: