Lineage for d3hksb1 (3hks B:16-84)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310711Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1311007Family b.34.5.0: automated matches [227245] (1 protein)
    not a true family
  6. 1311008Protein automated matches [227015] (3 species)
    not a true protein
  7. 1311014Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225759] (1 PDB entry)
  8. 1311016Domain d3hksb1: 3hks B:16-84 [211117]
    Other proteins in same PDB: d3hksa2, d3hksb2
    automated match to d1xtda1
    complexed with edo

Details for d3hksb1

PDB Entry: 3hks (more details), 2.3 Å

PDB Description: Crystal structure of eukaryotic translation initiation factor eIF-5A2 from Arabidopsis thaliana
PDB Compounds: (B:) Eukaryotic translation initiation factor 5A-2

SCOPe Domain Sequences for d3hksb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hksb1 b.34.5.0 (B:16-84) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sktypqsagnirkgghiviknrpckvvevstsktgkhghakchfvaidiftakkledivp
sshncdvph

SCOPe Domain Coordinates for d3hksb1:

Click to download the PDB-style file with coordinates for d3hksb1.
(The format of our PDB-style files is described here.)

Timeline for d3hksb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3hksb2