SCOPe 2.04: Domain d3hksb1: 3hks B:16-84

Lineage for d3hksb1 (3hks B:16-84)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families)
   many known members contain KOW motif

5. Family b.34.5.0: automated matches [227245] (1 protein)
   not a true family

6. Protein automated matches [227015] (5 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [225759] (1 PDB entry)

8. Domain d3hksb1: 3hks B:16-84 [211117]
   Other proteins in same PDB: d3hksa2, d3hksb2
   automated match to d1xtda1
   complexed with edo

Details for d3hksb1

PDB Entry: 3hks, 2.3 Å

PDB Description: Crystal structure of eukaryotic translation initiation factor eIF-5A2 from Arabidopsis thaliana

PDB Compounds: (B:) Eukaryotic translation initiation factor 5A-2

SCOPe Domain Sequences for d3hksb1:

Sequence; same for both SEQRES and ATOM records:

>d3hksb1 b.34.5.0 (B:16-84) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
sktypqsagnirkgghiviknrpckvvevstsktgkhghakchfvaidiftakkledivp
sshncdvph

Timeline for d3hksb1:

• d3hksb1 first appeared in SCOPe 2.03
  
• d3hksb1 appears in SCOPe 2.05
  
• d3hksb1 appears in the current release, SCOPe 2.08