Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) many known members contain KOW motif |
Family b.34.5.2: eIF5a N-terminal domain-like [50110] (3 proteins) |
Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species) |
Species Trypanosome (Leishmania mexicana) [TaxId:5665] [117167] (1 PDB entry) Uniprot Q9N9V6 97% sequence identity |
Domain d1xtda1: 1xtd A:24-94 [116015] Other proteins in same PDB: d1xtda2 |
PDB Entry: 1xtd (more details), 2.7 Å
SCOPe Domain Sequences for d1xtda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xtda1 b.34.5.2 (A:24-94) Eukaryotic initiation translation factor 5a (eIF5a) {Trypanosome (Leishmania mexicana) [TaxId: 5665]} nasktypmaagalkkggyvcingrpckvidlsvsktgkhghakvsivatdiftgnrledq apsthnvevpf
Timeline for d1xtda1: