Lineage for d1xtda1 (1xtd A:24-94)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1309919Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1310711Superfamily b.34.5: Translation proteins SH3-like domain [50104] (8 families) (S)
    many known members contain KOW motif
  5. 1310852Family b.34.5.2: eIF5a N-terminal domain-like [50110] (3 proteins)
  6. 1310857Protein Eukaryotic initiation translation factor 5a (eIF5a) [50111] (5 species)
  7. 1310869Species Trypanosome (Leishmania mexicana) [TaxId:5665] [117167] (1 PDB entry)
    Uniprot Q9N9V6 97% sequence identity
  8. 1310870Domain d1xtda1: 1xtd A:24-94 [116015]
    Other proteins in same PDB: d1xtda2

Details for d1xtda1

PDB Entry: 1xtd (more details), 2.7 Å

PDB Description: Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a
PDB Compounds: (A:) eukaryotic initiation factor 5a

SCOPe Domain Sequences for d1xtda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xtda1 b.34.5.2 (A:24-94) Eukaryotic initiation translation factor 5a (eIF5a) {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
nasktypmaagalkkggyvcingrpckvidlsvsktgkhghakvsivatdiftgnrledq
apsthnvevpf

SCOPe Domain Coordinates for d1xtda1:

Click to download the PDB-style file with coordinates for d1xtda1.
(The format of our PDB-style files is described here.)

Timeline for d1xtda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xtda2