SCOPe 2.06: Domain d3hj3a2: 3hj3 A:192-521

Lineage for d3hj3a2 (3hj3 A:192-521)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily)
contains large mixed beta-sheet
Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families)
automatically mapped to Pfam PF00303
Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins)
Protein automated matches [190469] (15 species)
not a true protein
Species Cryptosporidium hominis [TaxId:237895] [232024] (3 PDB entries)
Domain d3hj3a2: 3hj3 A:192-521 [232479]
Other proteins in same PDB: d3hj3a1, d3hj3b1, d3hj3c1, d3hj3d1
automated match to d1qzfa2
complexed with cb3, mtx, ndp, ump; mutant

Details for d3hj3a2

PDB Entry: 3hj3 (more details), 2.7 Å

PDB Description: crystal structure of the chts-dhfr f207a non-active site mutant

PDB Compounds: (A:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d3hj3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hj3a2 d.117.1.1 (A:192-521) automated matches {Cryptosporidium hominis [TaxId: 237895]}
qlksiddtvdllgeiagirkmgnrhkfpkeeiyntpsirfgrehyefqyldllsrvleng
ayrenrtgistysifgqmmrfdmresfpllttkkvairsifeeliwfikgdtngnhliek
kvyiwsgngskeyleriglghreendlgpiygfqwrhyngeyktmhddytgvgvdqlakl
ietlknnpkdrrhiltawnpsalsqmalppchvlsqyyvtndnclscnlyqrscdlglgs
pfniasyailtmmlaqvcgyepgelaifigdahiyenhltqlkeqlsrtprpfpqlkfkr
kveniedfkwedieligyypyptikmdmav

SCOPe Domain Coordinates for d3hj3a2:

Click to download the PDB-style file with coordinates for d3hj3a2.
(The format of our PDB-style files is described here.)

Timeline for d3hj3a2: