SCOPe 2.06: Domain d3hj3b1: 3hj3 B:3-180

Lineage for d3hj3b1 (3hj3 B:3-180)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (21 species)
   not a true protein

7. Species Cryptosporidium hominis [TaxId:237895] [231999] (4 PDB entries)

8. Domain d3hj3b1: 3hj3 B:3-180 [236018]
   Other proteins in same PDB: d3hj3a2, d3hj3b2, d3hj3c2, d3hj3d2
   automated match to d3hj3a1
   complexed with cb3, mtx, ndp, ump; mutant

Details for d3hj3b1

PDB Entry: 3hj3, 2.7 Å

PDB Description: crystal structure of the chts-dhfr f207a non-active site mutant

PDB Compounds: (B:) Chain A, crystal structure of Dhfr

SCOPe Domain Sequences for d3hj3b1:

Sequence; same for both SEQRES and ATOM records:

>d3hj3b1 c.71.1.0 (B:3-180) automated matches {Cryptosporidium hominis [TaxId: 237895]}
eknvsivvaasvlssgigingqlpwsisedlkffskitnnkcdsnkknalimgrktwdsi
grrplknriivvissslpqdeadpnvvvfrnledsienlmnddsienifvcggesiyrda
lkdnfvdriyltrvalediefdtyfpeipetflpvymsqtfctknisydfmifekqek

Timeline for d3hj3b1:

• d3hj3b1 first appeared in SCOPe 2.03
  
• d3hj3b1 appears in SCOPe 2.05
  
• d3hj3b1 appears in SCOPe 2.07
  
• d3hj3b1 appears in the current release, SCOPe 2.08