Lineage for d3hg0d_ (3hg0 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1944478Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1944479Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1944480Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
    this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain
  6. 1944572Protein automated matches [190101] (6 species)
    not a true protein
  7. 1944573Species Artificial gene [TaxId:32630] [193962] (5 PDB entries)
  8. 1944577Domain d3hg0d_: 3hg0 D: [232467]
    Other proteins in same PDB: d3hg0a1, d3hg0b1, d3hg0c1, d3hg0c2
    automated match to d1awcb_

Details for d3hg0d_

PDB Entry: 3hg0 (more details), 2.1 Å

PDB Description: Crystal structure of a DARPin in complex with ORF49 from Lactococcal phage TP901-1
PDB Compounds: (D:) Designed Ankyrin Repeat Protein (DARPin) 20

SCOPe Domain Sequences for d3hg0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hg0d_ d.211.1.1 (D:) automated matches {Artificial gene [TaxId: 32630]}
sdlgkklleaaragqddevrilmangadvnaedkvgltplhlaamndhleivevllknga
dvnaidaigetplhlvamyghleivevllkhgadvnaqdkfgktafdisidngnedlaei
lqkl

SCOPe Domain Coordinates for d3hg0d_:

Click to download the PDB-style file with coordinates for d3hg0d_.
(The format of our PDB-style files is described here.)

Timeline for d3hg0d_: