Lineage for d3hg0d1 (3hg0 D:13-135)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2238947Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 2238948Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 2238949Family d.211.1.1: Ankyrin repeat [48404] (19 proteins)
  6. 2239041Protein automated matches [190101] (7 species)
    not a true protein
  7. 2239042Species Artificial gene [TaxId:32630] [193962] (5 PDB entries)
  8. 2239046Domain d3hg0d1: 3hg0 D:13-135 [232467]
    Other proteins in same PDB: d3hg0a1, d3hg0a2, d3hg0b1, d3hg0c1, d3hg0c2, d3hg0d2
    automated match to d1awcb_

Details for d3hg0d1

PDB Entry: 3hg0 (more details), 2.1 Å

PDB Description: Crystal structure of a DARPin in complex with ORF49 from Lactococcal phage TP901-1
PDB Compounds: (D:) Designed Ankyrin Repeat Protein (DARPin) 20

SCOPe Domain Sequences for d3hg0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hg0d1 d.211.1.1 (D:13-135) automated matches {Artificial gene [TaxId: 32630]}
dlgkklleaaragqddevrilmangadvnaedkvgltplhlaamndhleivevllkngad
vnaidaigetplhlvamyghleivevllkhgadvnaqdkfgktafdisidngnedlaeil
qkl

SCOPe Domain Coordinates for d3hg0d1:

Click to download the PDB-style file with coordinates for d3hg0d1.
(The format of our PDB-style files is described here.)

Timeline for d3hg0d1: