Lineage for d3hbfa_ (3hbf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2911058Family c.87.1.0: automated matches [191559] (1 protein)
    not a true family
  6. 2911059Protein automated matches [190965] (40 species)
    not a true protein
  7. 2911150Species Medicago truncatula [TaxId:3880] [188985] (2 PDB entries)
  8. 2911151Domain d3hbfa_: 3hbf A: [177360]
    automated match to d2c1xa1
    complexed with myc, udp

Details for d3hbfa_

PDB Entry: 3hbf (more details), 2.1 Å

PDB Description: Structure of UGT78G1 complexed with myricetin and UDP
PDB Compounds: (A:) Flavonoid 3-O-glucosyltransferase

SCOPe Domain Sequences for d3hbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3hbfa_ c.87.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
nllhvavlafpfgthaapllslvkkiateapkvtfsffcttttndtlfsrsneflpniky
ynvhdglpkgyvssgnprepiflfikamqenfkhvideavaetgknitclvtdaffwfga
dlaeemhakwvplwtagphsllthvytdlirektgskevhdvksidvlpgfpelkasdlp
egvikdidvpfatmlhkmglelpranavainsfatihplienelnskfklllnvgpfnlt
tpqrkvsdehgclewldqhenssvvyisfgsvvtpppheltalaesleecgfpfiwsfrg
dpkeklpkgflertktkgkivawapqveilkhssvgvflthsgwnsvlecivggvpmisr
pffgdqglntiltesvleigvgvdngvltkesikkaleltmssekggimrqkivklkesa
fkaveqngtsamdfttliqivts

SCOPe Domain Coordinates for d3hbfa_:

Click to download the PDB-style file with coordinates for d3hbfa_.
(The format of our PDB-style files is described here.)

Timeline for d3hbfa_: