Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families) |
Family c.87.1.0: automated matches [191559] (1 protein) not a true family |
Protein automated matches [190965] (4 species) not a true protein |
Species Medicago truncatula [TaxId:3880] [188985] (2 PDB entries) |
Domain d3hbfa_: 3hbf A: [177360] automated match to d2c1xa1 complexed with myc, udp |
PDB Entry: 3hbf (more details), 2.1 Å
SCOPe Domain Sequences for d3hbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3hbfa_ c.87.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]} nllhvavlafpfgthaapllslvkkiateapkvtfsffcttttndtlfsrsneflpniky ynvhdglpkgyvssgnprepiflfikamqenfkhvideavaetgknitclvtdaffwfga dlaeemhakwvplwtagphsllthvytdlirektgskevhdvksidvlpgfpelkasdlp egvikdidvpfatmlhkmglelpranavainsfatihplienelnskfklllnvgpfnlt tpqrkvsdehgclewldqhenssvvyisfgsvvtpppheltalaesleecgfpfiwsfrg dpkeklpkgflertktkgkivawapqveilkhssvgvflthsgwnsvlecivggvpmisr pffgdqglntiltesvleigvgvdngvltkesikkaleltmssekggimrqkivklkesa fkaveqngtsamdfttliqivts
Timeline for d3hbfa_: