SCOPe 2.01: Domain d3hbfa_: 3hbf A:

Lineage for d3hbfa_ (3hbf A:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (12 families)

5. Family c.87.1.0: automated matches [191559] (1 protein)
   not a true family

6. Protein automated matches [190965] (4 species)
   not a true protein

7. Species Medicago truncatula [TaxId:3880] [188985] (2 PDB entries)

8. Domain d3hbfa_: 3hbf A: [177360]
   automated match to d2c1xa1
   complexed with myc, udp

Details for d3hbfa_

PDB Entry: 3hbf, 2.1 Å

PDB Description: Structure of UGT78G1 complexed with myricetin and UDP

PDB Compounds: (A:) Flavonoid 3-O-glucosyltransferase

SCOPe Domain Sequences for d3hbfa_:

Sequence; same for both SEQRES and ATOM records:

>d3hbfa_ c.87.1.0 (A:) automated matches {Medicago truncatula [TaxId: 3880]}
nllhvavlafpfgthaapllslvkkiateapkvtfsffcttttndtlfsrsneflpniky
ynvhdglpkgyvssgnprepiflfikamqenfkhvideavaetgknitclvtdaffwfga
dlaeemhakwvplwtagphsllthvytdlirektgskevhdvksidvlpgfpelkasdlp
egvikdidvpfatmlhkmglelpranavainsfatihplienelnskfklllnvgpfnlt
tpqrkvsdehgclewldqhenssvvyisfgsvvtpppheltalaesleecgfpfiwsfrg
dpkeklpkgflertktkgkivawapqveilkhssvgvflthsgwnsvlecivggvpmisr
pffgdqglntiltesvleigvgvdngvltkesikkaleltmssekggimrqkivklkesa
fkaveqngtsamdfttliqivts

Timeline for d3hbfa_:

• d3hbfa_ is new in SCOPe 2.01-stable
  
• d3hbfa_ appears in SCOPe 2.02
  
• d3hbfa_ appears in the current release, SCOPe 2.08