SCOPe 2.08: Domain d3gtub1: 3gtu B:85-224

Lineage for d3gtub1 (3gtu B:85-224)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
this domains follows the thioredoxin-like N-terminal domain
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
Protein Class mu GST [81348] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
Uniprot P09488 P28161
Domain d3gtub1: 3gtu B:85-224 [17612]
Other proteins in same PDB: d3gtua2, d3gtub2, d3gtuc2, d3gtud2

Details for d3gtub1

PDB Entry: 3gtu (more details), 2.8 Å

PDB Description: ligand-free heterodimeric human glutathione s-transferase m2-3 (ec 2.5.1.18), monoclinic crystal form

PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d3gtub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
rkhnmcgeteeekirvdiienqvmdfrtqlirlcyssdheklkpqyleelpgqlkqfsmf
lgkfswfagekltfvdfltydildqnrifdpkcldefpnlkafmcrfealekiaaylqsd
qfckmpinnkmaqwgnkpvc

SCOPe Domain Coordinates for d3gtub1:

Click to download the PDB-style file with coordinates for d3gtub1.
(The format of our PDB-style files is described here.)

Timeline for d3gtub1: