Lineage for d3gdfa_ (3gdf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846541Species Cladosporium herbarum [TaxId:29918] [189335] (2 PDB entries)
  8. 2846542Domain d3gdfa_: 3gdf A: [176525]
    automated match to d1vl8a_
    complexed with zn

Details for d3gdfa_

PDB Entry: 3gdf (more details), 2.5 Å

PDB Description: Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum.
PDB Compounds: (A:) Probable NADP-dependent mannitol dehydrogenase

SCOPe Domain Sequences for d3gdfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gdfa_ c.2.1.0 (A:) automated matches {Cladosporium herbarum [TaxId: 29918]}
mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga
eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg
sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka
gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg
ayvyfasdastyttgadllidggyttr

SCOPe Domain Coordinates for d3gdfa_:

Click to download the PDB-style file with coordinates for d3gdfa_.
(The format of our PDB-style files is described here.)

Timeline for d3gdfa_: