PDB entry 3gdf

View 3gdf on RCSB PDB site
Description: Crystal structure of the NADP-dependent mannitol dehydrogenase from Cladosporium herbarum.
Class: oxidoreductase
Keywords: Rossmann fold, beta-alpha-beta motifs, open twisted sheet, Allergen, NADP, Oxidoreductase
Deposited on 2009-02-24, released 2010-05-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-08-04, with a file datestamp of 2010-07-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.181
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable NADP-dependent mannitol dehydrogenase
    Species: Cladosporium herbarum [TaxId:29918]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gdfa_
  • Chain 'B':
    Compound: Probable NADP-dependent mannitol dehydrogenase
    Species: Cladosporium herbarum [TaxId:29918]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gdfb_
  • Chain 'C':
    Compound: Probable NADP-dependent mannitol dehydrogenase
    Species: Cladosporium herbarum [TaxId:29918]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gdfc_
  • Chain 'D':
    Compound: Probable NADP-dependent mannitol dehydrogenase
    Species: Cladosporium herbarum [TaxId:29918]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3gdfd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gdfA (A:)
    mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga
    eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg
    sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka
    gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg
    ayvyfasdastyttgadllidggyttr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gdfB (B:)
    mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga
    eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg
    sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka
    gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg
    ayvyfasdastyttgadllidggyttr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gdfC (C:)
    mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga
    eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg
    sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka
    gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg
    ayvyfasdastyttgadllidggyttr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3gdfD (D:)
    mpgqqatkheslldqlslkgkvvvvtgasgpkgmgieaargcaemgaavaityasraqga
    eenvkelektygikakaykcqvdsyesceklvkdvvadfgqidafianagatadsgildg
    sveawnhvvqvdlngtfhcakavghhfkergtgslvitasmsghianfpqeqtsynvaka
    gcihmarslanewrdfarvnsispgyidtglsdfvpketqqlwhsmipmgrdglakelkg
    ayvyfasdastyttgadllidggyttr