Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.3: Pseudopilin [117865] (2 proteins) automatically mapped to Pfam PF08334 |
Protein automated matches [191070] (2 species) not a true protein |
Species Escherichia coli O157:H7 [TaxId:83334] [188977] (1 PDB entry) |
Domain d3g20b_: 3g20 B: [176287] automated match to d1t92a_ complexed with ca, gol, na, nhe |
PDB Entry: 3g20 (more details), 1.78 Å
SCOPe Domain Sequences for d3g20b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g20b_ d.24.1.3 (B:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]} slvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptvqpep rnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtlgnaqp
Timeline for d3g20b_: