Lineage for d3g20b_ (3g20 B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022488Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 1022489Superfamily d.24.1: Pili subunits [54523] (7 families) (S)
    bacterial filament proteins
  5. 1022532Family d.24.1.3: Pseudopilin [117865] (2 proteins)
  6. 1022537Protein automated matches [191070] (1 species)
    not a true protein
  7. 1022538Species Escherichia coli O157:H7 [TaxId:83334] [188977] (1 PDB entry)
  8. 1022540Domain d3g20b_: 3g20 B: [176287]
    automated match to d1t92a_
    complexed with ca, gol, na, nhe

Details for d3g20b_

PDB Entry: 3g20 (more details), 1.78 Å

PDB Description: crystal structure of the major pseudopilin from the type 2 secretion system of enterohaemorrhagic escherichia coli
PDB Compounds: (B:) Type II secretion protein

SCOPe Domain Sequences for d3g20b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g20b_ d.24.1.3 (B:) automated matches {Escherichia coli O157:H7 [TaxId: 83334]}
slvvpnlmgnkdkadrqkvmsdlvalestldmyrldnnryptteqglralvskptvqpep
rnyrqdgyirrlpqdpwggdyqllnpgqysdidifspgpdgvpnteddignwtlgnaqp

SCOPe Domain Coordinates for d3g20b_:

Click to download the PDB-style file with coordinates for d3g20b_.
(The format of our PDB-style files is described here.)

Timeline for d3g20b_: