Lineage for d3g0ja_ (3g0j A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1993780Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1993781Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1993941Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1993942Protein automated matches [190615] (10 species)
    not a true protein
  7. 1993960Species Human (Homo sapiens) [TaxId:9606] [187641] (647 PDB entries)
  8. 1994117Domain d3g0ja_: 3g0j A: [210293]
    automated match to d2grca_
    complexed with edo, no3

Details for d3g0ja_

PDB Entry: 3g0j (more details), 1.78 Å

PDB Description: Crystal Structure of the fifth Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)
PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d3g0ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g0ja_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ispkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdm
ekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdl

SCOPe Domain Coordinates for d3g0ja_:

Click to download the PDB-style file with coordinates for d3g0ja_.
(The format of our PDB-style files is described here.)

Timeline for d3g0ja_: