SCOPe 2.03: Domain d3g0ja_: 3g0j A:

Lineage for d3g0ja_ (3g0j A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.0: automated matches [191428] (1 protein)
   not a true family

6. Protein automated matches [190615] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)

8. Domain d3g0ja_: 3g0j A: [210293]
   automated match to d2grca_
   complexed with edo, no3

Details for d3g0ja_

PDB Entry: 3g0j, 1.78 Å

PDB Description: Crystal Structure of the fifth Bromodomain of Human Poly-bromodomain containing protein 1 (PB1)

PDB Compounds: (A:) Protein polybromo-1

SCOPe Domain Sequences for d3g0ja_:

Sequence; same for both SEQRES and ATOM records:

>d3g0ja_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ispkkskymtpmqqklnevyeavknytdkrgrrlsaiflrlpsrselpdyyltikkpmdm
ekirshmmankyqdidsmvedfvmmfnnactynepesliykdalvlhkvlletrrdl

Timeline for d3g0ja_:

• d3g0ja_ is new in SCOPe 2.03-stable
  
• d3g0ja_ appears in SCOPe 2.04
  
• d3g0ja_ appears in the current release, SCOPe 2.08