Lineage for d3fzfa2 (3fzf A:189-381)
- Root: SCOPe 2.04
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) 
duplication contains two domains of this foldFamily c.55.1.0: automated matches [227137] (1 protein)
not a true familyProtein automated matches [226839] (42 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [224896] (40 PDB entries) 
Domain d3fzfa2: 3fzf A:189-381 [232213]
Other proteins in same PDB: d3fzfb_
automated match to d3l6qa2
complexed with atp
Details for d3fzfa2
PDB Entry: 3fzf (more details), 2.2 Å
PDB Description: Crystal Structure of Hsc70/Bag1 in complex with ATP
PDB Compounds: (A:) Heat shock cognate 71 kDa proteinSCOPe Domain Sequences for d3fzfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fzfa2 c.55.1.0 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails
SCOPe Domain Coordinates for d3fzfa2:
Click to download the PDB-style file with coordinates for d3fzfa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3fzfa2:
- d3fzfa2 first appeared in SCOPe 2.03
- d3fzfa2 appears in SCOPe 2.05
- d3fzfa2 appears in the current release, SCOPe 2.08
View in 3D
