SCOPe 2.08: Domain d3fzfa2: 3fzf A:189-381

Lineage for d3fzfa2 (3fzf A:189-381)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)

8. Domain d3fzfa2: 3fzf A:189-381 [232213]
   Other proteins in same PDB: d3fzfb1, d3fzfb2
   automated match to d3l6qa2
   complexed with atp

Details for d3fzfa2

PDB Entry: 3fzf, 2.2 Å

PDB Description: Crystal Structure of Hsc70/Bag1 in complex with ATP

PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3fzfa2:

Sequence; same for both SEQRES and ATOM records:

>d3fzfa2 c.55.1.0 (A:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

Timeline for d3fzfa2:

• d3fzfa2 first appeared in SCOPe 2.03
  
• d3fzfa2 appears in SCOPe 2.07