Lineage for d3fzfa1 (3fzf A:5-188)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2462168Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2462169Protein automated matches [226839] (53 species)
    not a true protein
  7. 2462308Species Human (Homo sapiens) [TaxId:9606] [224896] (58 PDB entries)
  8. 2462363Domain d3fzfa1: 3fzf A:5-188 [232212]
    Other proteins in same PDB: d3fzfb1, d3fzfb2
    automated match to d3l6qa1
    complexed with atp

Details for d3fzfa1

PDB Entry: 3fzf (more details), 2.2 Å

PDB Description: Crystal Structure of Hsc70/Bag1 in complex with ATP
PDB Compounds: (A:) Heat shock cognate 71 kDa protein

SCOPe Domain Sequences for d3fzfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fzfa1 c.55.1.0 (A:5-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt
ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl
tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg
ldkk

SCOPe Domain Coordinates for d3fzfa1:

Click to download the PDB-style file with coordinates for d3fzfa1.
(The format of our PDB-style files is described here.)

Timeline for d3fzfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fzfa2