Lineage for d3fv9b1 (3fv9 B:1-127)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413233Species Roseovarius nubinhibens [TaxId:89187] [225250] (4 PDB entries)
  8. 1413235Domain d3fv9b1: 3fv9 B:1-127 [210202]
    Other proteins in same PDB: d3fv9a2, d3fv9b2, d3fv9c2, d3fv9d2, d3fv9e2, d3fv9f2, d3fv9g2, d3fv9h2
    automated match to d1jpma2
    complexed with mg

Details for d3fv9b1

PDB Entry: 3fv9 (more details), 1.9 Å

PDB Description: crystal structure of putative mandelate racemase/muconatelactonizing enzyme from roseovarius nubinhibens ism complexed with magnesium
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d3fv9b1:

Sequence, based on SEQRES records: (download)

>d3fv9b1 d.54.1.0 (B:1-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
lkitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaa
haggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglp
lcdmtgg

Sequence, based on observed residues (ATOM records): (download)

>d3fv9b1 d.54.1.0 (B:1-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]}
lkitridihrtdlpvrggeyhsydativsietdtgltgwgestpfgstyiaahaggtraa
lellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglplcdmtgg

SCOPe Domain Coordinates for d3fv9b1:

Click to download the PDB-style file with coordinates for d3fv9b1.
(The format of our PDB-style files is described here.)

Timeline for d3fv9b1: