Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (95 species) not a true protein |
Species Roseovarius nubinhibens [TaxId:89187] [225250] (5 PDB entries) |
Domain d3fv9b1: 3fv9 B:2-127 [210202] Other proteins in same PDB: d3fv9a2, d3fv9a3, d3fv9b2, d3fv9b3, d3fv9c2, d3fv9c3, d3fv9d2, d3fv9d3, d3fv9e2, d3fv9e3, d3fv9f2, d3fv9f3, d3fv9g2, d3fv9g3, d3fv9h2, d3fv9h3 automated match to d1jpma2 complexed with mg |
PDB Entry: 3fv9 (more details), 1.9 Å
SCOPe Domain Sequences for d3fv9b1:
Sequence, based on SEQRES records: (download)
>d3fv9b1 d.54.1.0 (B:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} kitridihrtdlpvrggvyrlsggreyhsydativsietdtgltgwgestpfgstyiaah aggtraalellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglpl cdmtgg
>d3fv9b1 d.54.1.0 (B:2-127) automated matches {Roseovarius nubinhibens [TaxId: 89187]} kitridihrtdlpvrggeyhsydativsietdtgltgwgestpfgstyiaahaggtraal ellapailgmdprqhdriwdrmrdtlkghrdaraaldiacwdiaaqaaglplcdmtgg
Timeline for d3fv9b1: