Lineage for d3ekob_ (3eko B:)
- Root: SCOPe 2.02
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
8-stranded mixed beta-sheet; 2 layers: alpha/betaSuperfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (4 families) 
Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins) 
Protein HSP90 [55876] (3 species) Species Human (Homo sapiens) [TaxId:9606] [55878] (60 PDB entries)
Uniprot P08238 10-220 # HSP 90-beta isoform ! Uniprot P07900 16-223
Domain d3ekob_: 3eko B: [175020]
automated match to d1osfa_
complexed with po4, pyu
Details for d3ekob_
PDB Entry: 3eko (more details), 1.55 Å
PDB Description: Dihydroxylphenyl amides as inhibitors of the Hsp90 molecular chaperone
PDB Compounds: (B:) Heat shock protein HSP 90-alphaSCOPe Domain Sequences for d3ekob_:
Sequence, based on SEQRES records: (download)
>d3ekob_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadi
smigqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvil
hlkedqteyleerrikeivkkhsqfigypitlfvekel
Sequence, based on observed residues (ATOM records): (download)
>d3ekob_ d.122.1.1 (B:) HSP90 {Human (Homo sapiens) [TaxId: 9606]}
dqpmeeeevetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdps
kldsgkelhinlipnkqdrtltivdtgigmtkadlinnlgtiakgtkafmealqagadis
migqfgvgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilh
lkedqteyleerrikeivkkhsqfigypitlfvekel
SCOPe Domain Coordinates for d3ekob_:
Click to download the PDB-style file with coordinates for d3ekob_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3ekob_:
- d3ekob_ first appeared in SCOPe 2.01
- d3ekob_ appears in SCOPe 2.03
- d3ekob_ appears in the current release, SCOPe 2.08, called d3ekob1
View in 3D
