![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.22: SPRY domain [141154] (6 proteins) Pfam PF00622 |
![]() | Protein SPRY domain-containing SOCS box protein 2 [141159] (2 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [141160] (2 PDB entries) Uniprot O88838 12-224 |
![]() | Domain d3ek9a_: 3ek9 A: [175008] automated match to d2afja1 complexed with gol |
PDB Entry: 3ek9 (more details), 2.6 Å
SCOPe Domain Sequences for d3ek9a_:
Sequence, based on SEQRES records: (download)
>d3ek9a_ b.29.1.22 (A:) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} sdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpvaqstdgvrg krgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnseswgwdigrgkl yhqskgleapqypagpqgeqlvvperllvvldmeegtlgysiggtylgpafrglkgrtly psvsavwgqcqvrirymge
>d3ek9a_ b.29.1.22 (A:) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]} sdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpvaqstdgvrg krgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnseswgwdigrgkl yhqskapqypageqlvvperllvvldmeegtlgysiggtylgpafrglkgrtlypsvsav wgqcqvrirymge
Timeline for d3ek9a_: