Lineage for d2afja1 (2afj A:12-224)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780523Family b.29.1.22: SPRY domain [141154] (6 proteins)
    Pfam PF00622
  6. 2780541Protein SPRY domain-containing SOCS box protein 2 [141159] (2 species)
  7. 2780545Species Mouse (Mus musculus) [TaxId:10090] [141160] (2 PDB entries)
    Uniprot O88838 12-224
  8. 2780547Domain d2afja1: 2afj A:12-224 [126693]
    Other proteins in same PDB: d2afja2, d2afja3

Details for d2afja1

PDB Entry: 2afj (more details)

PDB Description: spry domain-containing socs box protein 2 (ssb-2)
PDB Compounds: (A:) gene rich cluster, C9 gene

SCOPe Domain Sequences for d2afja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2afja1 b.29.1.22 (A:12-224) SPRY domain-containing SOCS box protein 2 {Mouse (Mus musculus) [TaxId: 10090]}
stptsqalysdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpv
aqstdgvrgkrgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnsesw
gwdigrgklyhqskgleapqypagpqgeqlvvperllvvldmeegtlgysiggtylgpaf
rglkgrtlypsvsavwgqcqvrirymgerrvee

SCOPe Domain Coordinates for d2afja1:

Click to download the PDB-style file with coordinates for d2afja1.
(The format of our PDB-style files is described here.)

Timeline for d2afja1: