PDB entry 3ek9

View 3ek9 on RCSB PDB site
Description: SPRY Domain-containing SOCS Box Protein 2: Crystal Structure and Residues Critical for Protein Binding
Class: protein binding
Keywords: SPRY domain, Ubl conjugation pathway, SIGNALING PROTEIN, PROTEIN BINDING
Deposited on 2008-09-19, released 2009-02-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-02-08, with a file datestamp of 2012-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.173
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SPRY domain-containing SOCS box protein 2
    Species: Mus musculus [TaxId:10090]
    Gene: SPSB2, GRCC9, SSB2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ek9a_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ek9A (A:)
    stptsqalysdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpv
    aqstdgvrgkrgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnsesw
    gwdigrgklyhqskgleapqypagpqgeqlvvperllvvldmeegtlgysiggtylgpaf
    rglkgrtlypsvsavwgqcqvrirymgerrvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ek9A (A:)
    sdfsppegleellsapppdlvaqrhhgwnpkdcsenidvkegglcferrpvaqstdgvrg
    krgysrglhaweiswpleqrgthavvgvatalaplqadhyaallgsnseswgwdigrgkl
    yhqskapqypageqlvvperllvvldmeegtlgysiggtylgpafrglkgrtlypsvsav
    wgqcqvrirymge