Lineage for d3cr3a1 (3cr3 A:1-192)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349591Fold a.208: DhaL-like [101472] (1 superfamily)
    multihelical; bundle
  4. 2349592Superfamily a.208.1: DhaL-like [101473] (2 families) (S)
  5. 2349593Family a.208.1.1: DhaL-like [101474] (2 proteins)
    automatically mapped to Pfam PF02734
  6. 2349600Protein PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL [158829] (1 species)
  7. 2349601Species Lactococcus lactis [TaxId:1358] [158830] (1 PDB entry)
    Uniprot Q9CIV7 1-192
  8. 2349602Domain d3cr3a1: 3cr3 A:1-192 [156937]
    Other proteins in same PDB: d3cr3c_, d3cr3d_
    complexed with adp, mg

Details for d3cr3a1

PDB Entry: 3cr3 (more details), 2.1 Å

PDB Description: Structure of a transient complex between Dha-kinase subunits DhaM and DhaL from Lactococcus lactis
PDB Compounds: (A:) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL

SCOPe Domain Sequences for d3cr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cr3a1 a.208.1.1 (A:1-192) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL {Lactococcus lactis [TaxId: 1358]}
lltidttiewlgkfnekiqenkaylseldgpigdgdhganmargmsetmkalevsnfgnv
seifkkvamtlmskvggasgplygsaflamsktaietldtseliyagleaiqkrgkaqvg
ektmvdiwsaflndlqtdsaskdnlekvvkasagllatkgrasylgersighidpgtqss
aylfetllevva

SCOPe Domain Coordinates for d3cr3a1:

Click to download the PDB-style file with coordinates for d3cr3a1.
(The format of our PDB-style files is described here.)

Timeline for d3cr3a1: