Lineage for d3cr3a1 (3cr3 A:1-192)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780194Fold a.208: DhaL-like [101472] (1 superfamily)
    multihelical; bundle
  4. 780195Superfamily a.208.1: DhaL-like [101473] (1 family) (S)
  5. 780196Family a.208.1.1: DhaL-like [101474] (2 proteins)
  6. 780203Protein PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL [158829] (1 species)
  7. 780204Species Lactococcus lactis [TaxId:1358] [158830] (1 PDB entry)
    Uniprot Q9CIV7 1-192
  8. 780205Domain d3cr3a1: 3cr3 A:1-192 [156937]
    Other proteins in same PDB: d3cr3c1, d3cr3d1
    complexed with adp, mg

Details for d3cr3a1

PDB Entry: 3cr3 (more details), 2.1 Å

PDB Description: Structure of a transient complex between Dha-kinase subunits DhaM and DhaL from Lactococcus lactis
PDB Compounds: (A:) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit dhaL

SCOP Domain Sequences for d3cr3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cr3a1 a.208.1.1 (A:1-192) PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL {Lactococcus lactis [TaxId: 1358]}
lltidttiewlgkfnekiqenkaylseldgpigdgdhganmargmsetmkalevsnfgnv
seifkkvamtlmskvggasgplygsaflamsktaietldtseliyagleaiqkrgkaqvg
ektmvdiwsaflndlqtdsaskdnlekvvkasagllatkgrasylgersighidpgtqss
aylfetllevva

SCOP Domain Coordinates for d3cr3a1:

Click to download the PDB-style file with coordinates for d3cr3a1.
(The format of our PDB-style files is described here.)

Timeline for d3cr3a1: