Lineage for d3bi7a1 (3bi7 A:414-617)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.122: PUA domain-like [88696] (1 superfamily)
pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each otherSuperfamily b.122.1: PUA domain-like [88697] (15 families) 
Family b.122.1.12: SRA domain-like [159368] (2 proteins)
Pfam PF02182; recognizes the modified cytosine base (m5C) by flipping it out of DNAProtein E3 ubiquitin-protein ligase UHRF1 [159369] (2 species) 
Species Human (Homo sapiens) [TaxId:9606] [159370] (4 PDB entries)
Uniprot Q96T88 409-615! Uniprot Q96T88 414-617
Domain d3bi7a1: 3bi7 A:414-617 [155298]
Other proteins in same PDB: d3bi7a2
complexed with edo, so4, unl
Details for d3bi7a1
PDB Entry: 3bi7 (more details), 1.7 Å
PDB Description: Crystal structure of the SRA domain of E3 ubiquitin-protein ligase UHRF1
PDB Compounds: (A:) E3 ubiquitin-protein ligase UHRF1SCOPe Domain Sequences for d3bi7a1:
Sequence, based on SEQRES records: (download)
>d3bi7a1 b.122.1.12 (A:414-617) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
psnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhg
nfftytgsggrdlsgnkrtaeqscdqkltntnralalncfapindqegaeakdwrsgkpv
rvvrnvkggknskyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtke
gkdrikklgltmqypegylealan
Sequence, based on observed residues (ATOM records): (download)
>d3bi7a1 b.122.1.12 (A:414-617) E3 ubiquitin-protein ligase UHRF1 {Human (Homo sapiens) [TaxId: 9606]}
psnhygpipgipvgtmwrfrvqvsesgvhrphvagihgrsndgayslvlaggyeddvdhg
nfftytgsggscdqkltntnralalncfapindqegaeakdwrsgkpvrvvrnvkggkns
kyapaegnrydgiykvvkywpekgksgflvwryllrrdddepgpwtkegkdrikklgltm
qypegylealan
SCOPe Domain Coordinates for d3bi7a1:
Click to download the PDB-style file with coordinates for d3bi7a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3bi7a1:
- d3bi7a1 first appeared in SCOP 1.75
- d3bi7a1 appears in SCOPe 2.07
View in 3D
