![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies) 3 helices; bundle, right-handed twist |
![]() | Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) ![]() |
![]() | Family a.5.3.0: automated matches [227224] (1 protein) not a true family |
![]() | Protein automated matches [226965] (4 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225408] (5 PDB entries) |
![]() | Domain d3b7na1: 3b7n A:4-94 [208549] Other proteins in same PDB: d3b7na2 automated match to d1auaa1 complexed with act, b7n, po4 |
PDB Entry: 3b7n (more details), 1.86 Å
SCOPe Domain Sequences for d3b7na1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b7na1 a.5.3.0 (A:4-94) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} sildtypqicspnalpgtpgnltkeqeeallqfrsilleknykerlddstllrflrarkf dinasvemfveterwreeygantiiedyenn
Timeline for d3b7na1: