SCOP 1.75: Domain d3b5ha1: 3b5h A:103-203

Lineage for d3b5ha1 (3b5h A:103-203)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.4: I set domains [49159] (38 proteins)
Protein Cervical EMMPRIN [158877] (1 species)
contains two Ig-domains in the N-terminal part
Species Human (Homo sapiens) [TaxId:9606] [158878] (1 PDB entry)
Uniprot Q54A51 103-203! Uniprot Q54A51 23-102
Domain d3b5ha1: 3b5h A:103-203 [154838]
complexed with act

Details for d3b5ha1

PDB Entry: 3b5h (more details), 2.8 Å

PDB Description: crystal structure of the extracellular portion of hab18g/cd147

PDB Compounds: (A:) Cervical EMMPRIN

SCOP Domain Sequences for d3b5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]}
gpprvkavkssehinegetamlvcksesvppvtdwawykitdsedkalmngsesrffvss
sqgrselhienlnmeadpgqyrcngtsskgsdqaiitlrvr

SCOP Domain Coordinates for d3b5ha1:

Click to download the PDB-style file with coordinates for d3b5ha1.
(The format of our PDB-style files is described here.)

Timeline for d3b5ha1: