SCOP 1.75: Domain d3b5hc1: 3b5h C:103-202

Lineage for d3b5hc1 (3b5h C:103-202)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Cervical EMMPRIN [158877] (1 species)
   contains two Ig-domains in the N-terminal part

7. Species Human (Homo sapiens) [TaxId:9606] [158878] (1 PDB entry)
   Uniprot Q54A51 103-203! Uniprot Q54A51 23-102

8. Domain d3b5hc1: 3b5h C:103-202 [154842]
   automatically matched to 3B5H A:103-203
   complexed with act

Details for d3b5hc1

PDB Entry: 3b5h, 2.8 Å

PDB Description: crystal structure of the extracellular portion of hab18g/cd147

PDB Compounds: (C:) Cervical EMMPRIN

SCOP Domain Sequences for d3b5hc1:

Sequence; same for both SEQRES and ATOM records:

>d3b5hc1 b.1.1.4 (C:103-202) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]}
gpprvkavkssehinegetamlvcksesvppvtdwawykitdsedkalmngsesrffvss
sqgrselhienlnmeadpgqyrcngtsskgsdqaiitlrv

Timeline for d3b5hc1:

• d3b5hc1 is new in SCOP 1.75
  
• d3b5hc1 appears in SCOPe 2.01
  
• d3b5hc1 appears in the current release, SCOPe 2.08