| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
| Family d.15.4.1: 2Fe-2S ferredoxin-related [54293] (4 proteins) |
| Protein automated matches [190231] (8 species) not a true protein |
| Species Leptolyngbya boryana [TaxId:1184] [195189] (1 PDB entry) |
| Domain d3b2ga_: 3b2g A: [195191] automated match to d1rfka_ complexed with fes |
PDB Entry: 3b2g (more details), 1.76 Å
SCOPe Domain Sequences for d3b2ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2ga_ d.15.4.1 (A:) automated matches {Leptolyngbya boryana [TaxId: 1184]}
psfkvtlineteglnttievpddeyildaaeeqgidlpyscragacstcagkitagtvdq
sdqsfldddqiqagyvltcvayptsdctilthqeedly
Timeline for d3b2ga_: