PDB entry 3b2g

View 3b2g on RCSB PDB site
Description: Leptolyngbya boryana Ferredoxin
Class: electron transport
Keywords: electron transfer, FNR, NiR, SiR, Fd-GOGAT, ELECTRON TRANSPORT
Deposited on 2011-08-01, released 2012-06-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ferredoxin-1
  Species: Leptolyngbya boryana [TaxId:1184]
  Gene: petF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51577 (0-97)
  Domains in SCOPe 2.04: d3b2ga_
• Chain 'B':
  Compound: Ferredoxin-1
  Species: Leptolyngbya boryana [TaxId:1184]
  Gene: petF1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q51577 (0-97)
  Domains in SCOPe 2.04: d3b2gb_
• Heterogens: FES, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b2gA (A:)
  psfkvtlineteglnttievpddeyildaaeeqgidlpyscragacstcagkitagtvdq
  sdqsfldddqiqagyvltcvayptsdctilthqeedly
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3b2gB (B:)
  psfkvtlineteglnttievpddeyildaaeeqgidlpyscragacstcagkitagtvdq
  sdqsfldddqiqagyvltcvayptsdctilthqeedly