PDB entry 3b2g

View 3b2g on RCSB PDB site
Description: Leptolyngbya boryana Ferredoxin
Class: electron transport
Keywords: electron transfer, FNR, NiR, SiR, Fd-GOGAT, ELECTRON TRANSPORT
Deposited on 2011-08-01, released 2012-06-13
The last revision prior to the SCOPe 2.04 freeze date was dated 2012-06-13, with a file datestamp of 2012-06-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.185
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferredoxin-1
    Species: Leptolyngbya boryana [TaxId:1184]
    Gene: petF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b2ga_
  • Chain 'B':
    Compound: Ferredoxin-1
    Species: Leptolyngbya boryana [TaxId:1184]
    Gene: petF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d3b2gb_
  • Heterogens: FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2gA (A:)
    psfkvtlineteglnttievpddeyildaaeeqgidlpyscragacstcagkitagtvdq
    sdqsfldddqiqagyvltcvayptsdctilthqeedly
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3b2gB (B:)
    psfkvtlineteglnttievpddeyildaaeeqgidlpyscragacstcagkitagtvdq
    sdqsfldddqiqagyvltcvayptsdctilthqeedly