Lineage for d3a5ua_ (3a5u A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1540029Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1541119Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1541191Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 1541383Protein automated matches [190206] (8 species)
    not a true protein
  7. 1541439Species Mycobacterium smegmatis [TaxId:246196] [189407] (1 PDB entry)
  8. 1541440Domain d3a5ua_: 3a5u A: [171758]
    automated match to d1ue1b_
    protein/DNA complex

Details for d3a5ua_

PDB Entry: 3a5u (more details), 2.8 Å

PDB Description: Promiscuity and specificity in DNA binding to SSB: Insights from the structure of the Mycobacterium smegmatis SSB-ssDNA complex
PDB Compounds: (A:) Single-stranded DNA-binding protein

SCOPe Domain Sequences for d3a5ua_:

Sequence, based on SEQRES records: (download)

>d3a5ua_ b.40.4.3 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
reaaenvaesltrgsrvivtgrlkqrsfetregekrtvvevevdeigpslryatakvnk

Sequence, based on observed residues (ATOM records): (download)

>d3a5ua_ b.40.4.3 (A:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
magdttitvvgnltadpelrftpsgaavanftvastprmfdrqsgewkdgealflrcniw
reaaenvaesltrgsrvivtgrlkqrsftregekrtvvevevdeigpslryatakvnk

SCOPe Domain Coordinates for d3a5ua_:

Click to download the PDB-style file with coordinates for d3a5ua_.
(The format of our PDB-style files is described here.)

Timeline for d3a5ua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3a5ub_